Home/Images/KENNEDY SPACE CENTER, FLA. - A worker sandblasts the surface behind the Mobile Launcher Platform on Launch Pad 39A . Routine maintenance includes sandblasting and repainting as pr

KENNEDY SPACE CENTER, FLA. - A worker sandblasts the surface behind the Mobile Launcher Platform on Launch Pad 39A . Routine maintenance includes sandblasting and repainting as pr

KENNEDY SPACE CENTER, FLA. - A worker sandblasts the surface behind the Mobile Launcher Platform on Launch Pad 39A . Routine

License

PUBLIC DOMAIN

View license terms

"KENNEDY SPACE CENTER, FLA. - A worker sandblasts the surface behind the Mobile Launcher Platform on Launch Pad 39A . Routine maintenance includes sandblasting and repainting as preventive means to minimize corrosion." (KSC-03pd2660) by KSC, Public Domain — NASA Image and Video Library

Source

KSC · NASA Image Library

Original source

Specs

3000 × 1955 · JPEG · ratio 1.53

Palette

#cce5fa · #c9dfef · #726241 · #857451 · #5f5f43 · #5b4d32

AI prompt

KENNEDY SPACE CENTER, FLA. - A worker sandblasts the surface behind the Mobile Launcher Platform on Launch Pad 39A . Routine maintenance includes sandblasting and repainting as preventive means to minimize corrosion. — bright, airy — richly saturated — landscape orientation — nasa, space, kennedy, space, center, fla — color palette: #cce5fa, #c9dfef, #726241, #857451, #5f5f43. Reference resolution 3000x1955.

Tags

nasaspacekennedyspacecenterflaworkersandblastssurfacebehindmobilelauncherplatformlaunch